SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A3RWP6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A3RWP6
Domain Number 1 Region: 3-71
Classification Level Classification E-value
Superfamily MbtH-like 3.27e-31
Family MbtH-like 0.00031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A3RWP6
Sequence length 76
Comment (tr|A0A1A3RWP6|A0A1A3RWP6_MYCGO) Protein mbtH {ECO:0000313|EMBL:OBJ80164.1} KW=Complete proteome OX=1778 OS=Mycobacterium gordonae. GN=A9W97_28185 OC=Mycobacterium.
Sequence
MSVNPFDDENGSFVVLINDEEQHSLWPTFADVPAGWRVVYGEAARADCLEYIEQNWPDIR
PKSLRDRLDQQRASDN
Download sequence
Identical sequences A0A1A3RWP6
WP_065045972.1.101249 WP_065045972.1.5931

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]