SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A5PVI1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A5PVI1
Domain Number 1 Region: 4-94
Classification Level Classification E-value
Superfamily YccV-like 2.88e-35
Family YccV-like 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A5PVI1
Sequence length 107
Comment (tr|A0A1A5PVI1|A0A1A5PVI1_RHILI) DNA-binding protein {ECO:0000313|EMBL:OBP72650.1} KW=Complete proteome OX=381 OS=Rhizobium loti (Mesorhizobium loti). GN=BAE39_19000 OC=Phyllobacteriaceae; Mesorhizobium.
Sequence
MKTAKFAIGQVVRHRLFPFRGIIFDVDPQFANTDEWYEAIPADVRPRKDQPFYHLLAENS
ETEYIAYVSEQNLLEDRSGEPVRHPQIKEMFDKRPDGRYEPKRQSRH
Download sequence
Identical sequences A0A1A5PVI1 A0A1E2SZI3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]