SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A5X0U7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A5X0U7
Domain Number 1 Region: 17-235
Classification Level Classification E-value
Superfamily Chemotaxis phosphatase CheZ 8.63e-61
Family Chemotaxis phosphatase CheZ 0.000000881
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A5X0U7
Sequence length 236
Comment (tr|A0A1A5X0U7|A0A1A5X0U7_9BURK) Chemotaxis protein CheZ {ECO:0000256|PIRNR:PIRNR002884} KW=Complete proteome; Reference proteome OX=92647 OS=Paraburkholderia tropica. GN=A6456_29825 OC=Burkholderiaceae; Paraburkholderia.
Sequence
MNEPIDAAHDGAAESGDLATDRILARIGQLTRTLRDSMRELGLDKHVERAAEAVPDARDR
LRYVANMTEQAAERVLSAIEVAKPMQEQVEADAKVLSSRWATWYDAPIGREEVRSLMDDT
RQFLDGVPQVTTATNQQLLEIMLAQDFQDLTGQVIKKIMDVVYVIEQQLLTVLVENIAPE
RREQFAATAALLAEAQASSTGSPEGLLNGPQINPEGKTDVVQDQAQVDDLLASLGF
Download sequence
Identical sequences A0A1A5X0U7
WP_065065605.1.14213 WP_065065605.1.29722 WP_065065605.1.99330

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]