SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A5ZWN4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A5ZWN4
Domain Number 1 Region: 24-158
Classification Level Classification E-value
Superfamily LigT-like 0.000000628
Family tRNA splicing product Appr>p cyclic nucleotide phosphodiesterase 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A5ZWN4
Sequence length 203
Comment (tr|A0A1A5ZWN4|A0A1A5ZWN4_9TREE) Uncharacterized protein {ECO:0000313|EMBL:OBR82217.1} KW=Complete proteome; Reference proteome OX=1296121 OS=Kwoniella dejecticola CBS 10117. GN=I303_06976 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Kwoniella.
Sequence
MSPPRQLQSPIILTLRLDKATHQLLTGLRSKYFPPHRNFLTAHVTLFHAIPAHRFDELDH
QLNSICSSRSGWDVFFGEPEKMGNRGVYLLCRERPSSTVEKIHRQLLSDLKKGIQDDKDK
LTNQDLQPMRRPHVTVLNKASSEEEVDTCLKEVKELFDGMKKDGQKEGQHKGRAVGFEVW
EYLGGPWKSIKEYSFQGEGEGSG
Download sequence
Identical sequences A0A1A5ZWN4
XP_018260059.1.23705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]