SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A5ZWV2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A5ZWV2
Domain Number 1 Region: 24-119
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000000000000175
Family Txnl5-like 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A5ZWV2
Sequence length 119
Comment (tr|A0A1A5ZWV2|A0A1A5ZWV2_9TREE) Uncharacterized protein {ECO:0000313|EMBL:OBR82286.1} KW=Complete proteome; Reference proteome OX=1296121 OS=Kwoniella dejecticola CBS 10117. GN=I303_07045 OC=Tremellomycetes; Tremellales; Cryptococcaceae; Kwoniella.
Sequence
MPLLANPFPHIMNSLNGPTAPPVSYLVFYSDVVNGQMWCPDCRDVEQVVKDTFDGQDKPK
AIIYWVGPIAEWRTPKNKARVDWNVQSIPTILRIENGKETARLVEDEILDKKRLEAFLK
Download sequence
Identical sequences A0A1A5ZWV2
XP_018260128.1.23705

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]