SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A6GFK5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A6GFK5
Domain Number 1 Region: 90-133
Classification Level Classification E-value
Superfamily Orange domain-like 0.000000000314
Family Hairy Orange domain 0.0055
Further Details:      
 
Domain Number 2 Region: 17-75
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 0.000000000864
Family HLH, helix-loop-helix DNA-binding domain 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A6GFK5
Sequence length 224
Comment (tr|A0A1A6GFK5|A0A1A6GFK5_NEOLE) Uncharacterized protein {ECO:0000313|EMBL:OBS65016.1} KW=Complete proteome; Reference proteome OX=56216 OS=Neotoma lepida (Desert woodrat). GN=A6R68_06455 OC=Muroidea; Cricetidae; Neotominae; Neotoma.
Sequence
MSPPLAPSRDRAGHEDEDRWERRGDRKARKPLVEKKRRARINESLQELRLLLAGTEVQAK
LENAEVLELTVRRVQGALRGRAREREQLQAEASERFAAGYIQCMHEVHTFVSTCQAIDAT
VSAELLNHLLESMPLREGSSFRDLLGDSLAGLPGGPGRITWPPGGSPGSPLSSPPGPGDD
LCSDLEEVPEAELNRVSAEGPDLVPTSLGSLTSARLAQSVWRPW
Download sequence
Identical sequences A0A1A6GFK5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]