SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A6GWB2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A6GWB2
Domain Number 1 Region: 2-26
Classification Level Classification E-value
Superfamily Blood coagulation inhibitor (disintegrin) 0.0000986
Family Blood coagulation inhibitor (disintegrin) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A6GWB2
Sequence length 137
Comment (tr|A0A1A6GWB2|A0A1A6GWB2_NEOLE) Uncharacterized protein {ECO:0000313|EMBL:OBS69637.1} KW=Complete proteome; Reference proteome OX=56216 OS=Neotoma lepida (Desert woodrat). GN=A6R68_01822 OC=Muroidea; Cricetidae; Neotominae; Neotoma.
Sequence
FQSRGYECRDAVNSCDITEYCTGDSGQGRCYNGECKTRDNQCQYIWGTILDDDTDVGYVE
DGTPCGPSMMCLDRKCLQIQALNMSSCPLDSKGKVCSGHGVCSNEATCICDFTWAGTDCS
IRDPVRNPNPPKDEGPK
Download sequence
Identical sequences A0A1A6GWB2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]