SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A6HPM1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A6HPM1
Domain Number 1 Region: 171-536
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.71e-91
Family Ankyrin repeat 0.00000385
Further Details:      
 
Domain Number 2 Region: 883-1164
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.24e-67
Family Ankyrin repeat 0.0000163
Further Details:      
 
Domain Number 3 Region: 106-202
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000000000405
Family Pseudo ankyrin repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A6HPM1
Sequence length 1279
Comment (tr|A0A1A6HPM1|A0A1A6HPM1_NEOLE) Uncharacterized protein {ECO:0000313|EMBL:OBS80194.1} KW=Complete proteome; Reference proteome OX=56216 OS=Neotoma lepida (Desert woodrat). GN=A6R68_21607 OC=Muroidea; Cricetidae; Neotominae; Neotoma.
Sequence
VESFILDQDDLENPMLETASKLLLSGTADGADLRTVDPETQARLEALLEAAGIGKLSTAD
GKAFADPEVLRRLTSSVSCALDEAAAALTRMRAESTANAGQSDNRSLAEACSEGDVNAVR
KLLIEGRSVNEHTEEGESLLCLACSAGYYELAQVLLAMHANVEDRGIKGDITPLMAAANG
GHVKIVKLLLAHKADVNAQSSTGNTALTYACAGGYVDVVKVLLESGASIEDHNENGHTPL
MEAGSAGHVEVARLLLENGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKT
DEMHTALMEACMDGHVEVARLLLDSGAQVNMPADSFESPLTLAACGGHVELAALLIERGA
SLEEVNDEGYTPLMEAAREGHEEMVALLLGQGANINAQTEETQETALTLACCGGFLEVAD
FLIKAGADIELGCSTPLMEAAQEGHLELVKYLLAAGANVNRTTANNDHTVLSLACAGGHL
AVVELLLAHGADPTHRLKDGSTMLIEAAKGGHTSVVCYLLDYPNNLLSAPPPDVTQLTPP
SHDLNRAPRVPVQALPMVVPPQEPDKPPANVAATLPVRNKAASKQKSNSHLPANSQDVQG
YITNQSPESIVEEAQGKLTELEQRIKEAIEKNAQLQSLELAHADQLTKEKIEELNKTREE
QIQKKQKILEELQKVERELQLKTQQQLKKQYLEVKAQRIQLQQQQQQSCQHLGLLTPVGV
GEQLSEGDYARLQQVDPVLLKDEPQQTAAQMGFAPIQPLAMPQALPLAAGPLPPGSIANL
TELQGVIVGQPVLGQAQLAGLGQGILTETQQGLMVASPAQTLNDTLDDIMAAVSGRASAM
SNTPTHSIAASISQPQTPXPSPIISPSAMLPIYPAIDIDAQTESNHDTALTLACAGGHEE
LVQTLLERGASIEHRDKKGFTPLILAATAGHVGVVEILLDNGADIEAQSERTKDTPLSLA
CSGGRQEVVELLLARGANKEHRNVSDYTPLSLAASAAMNGHTAAVKLLLDMGSDINAQIE
TNRNTALTLACFQGRTEVTGLTPLMEAASGGYAEVGRVLLDKGADVNAPPVPSSRDTALT
IAADKGHYKFCELLIGRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVQAGADVDAADNR
KITPLMAAFRKGHVKVVRYLVKEVNQFPSDSECMRYIATITDKEMLKKCHLCMESIVQAK
DRQAAEANKNASILLEELDLEKLREESRRLALAAKREKRKEKRRKKKEEQRRKLEEIEAK
NKENFELQAAQEKEKLKAE
Download sequence
Identical sequences A0A1A6HPM1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]