SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7MDF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7MDF2
Domain Number 1 Region: 795-862
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.000000085
Family Pseudo ankyrin repeat 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A7MDF2
Sequence length 874
Comment (tr|A0A1A7MDF2|A0A1A7MDF2_AURPU) Uncharacterized protein {ECO:0000313|EMBL:OBW64667.1} OX=5580 OS=Aureobasidium pullulans (Black yeast) (Pullularia pullulans). GN=AUREO_052670 OC=Aureobasidium.
Sequence
MITITTNNPDIVEANRWSHIPGSLTSRIHPKCEDAIIPVGSTFNTNQTALSYQLVSLRNH
LALSYHNRRLAFCEVTQILIDFQTSDDRQAALIDRSSWGVTVSADITCNAPNEEHEFSNI
GFRTHYDPLSWAAEPGVSGFIRVNASSPGFLWANTLLLAFWTETVTTIVDQTIQPNSSEI
VPQFNLSSGYISFSRPGININNESFFHLGKYAFFNLPESKAYKGNFGVQGDTLYEDFITN
NTWPNIWSPANRLARAMYSVIQVDLGQTDTVITTFDGTPTDTSILTTADRLHHWTENLTQ
IWDRSTVADKDNLLPYGWMQMRQFDKDTDATDPRQPLRFTPSVRAVTEDDTGIEVLYQPS
NPNIDIVAIHGLGAHPDDTWCKNIGTPESPQWVNWLKEPDMLPSTASNVRIMRYGYESAW
FGSDAIKQSTTDAAEEFLDDLKGLREAMIHARLHSKRWPDLLSFTTGLIFFGTPFRGAEG
ISQSELLQAAIEEHKVVEAQALRILDPGNDPLEDLVTDFCRLHSVPHKAQIACFFEQKPS
NIMAILGKNAQKSFVVSRSSGCLDESESTQKYRLARTHFDMNKFGKPSERGFMKVAQVIK
SMVEAAPNLLLSRLEVDEPKSIAAVRRLVEVTGSSLEEKRLESAEKVQEDISTAIKLAFQ
KANFTRDVMTDFRLGPQPAYHAIDDVESILAIVRLNTTVKINKRTQHRFSSHSTSRLVTQ
ALHDSIGLANGRFDILTTKRSTEAGLDVSFMSVITFTADKSQYKQFMLSIHLIQIHGLDG
SNVLSPCIIGHAVIPDDAPILQAIRDGNLEEFKRLLENGQARVWDCDSDGRSLLNVAVHS
HEPTMVEYLVAQGLDVNSVEVSLGFLSRRKLGIP
Download sequence
Identical sequences A0A1A7MDF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]