SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7MM14 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7MM14
Domain Number 1 Region: 338-459
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.51e-31
Family cAMP-binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 199-336
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.17e-27
Family cAMP-binding domain 0.000064
Further Details:      
 
Domain Number 3 Region: 3-40
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000262
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A7MM14
Sequence length 491
Comment (tr|A0A1A7MM14|A0A1A7MM14_AURPU) cAMP-dependent protein kinase regulatory subunit {ECO:0000256|PIRNR:PIRNR000548} OX=5580 OS=Aureobasidium pullulans (Black yeast) (Pullularia pullulans). GN=AUREO_025340 OC=Aureobasidium.
Sequence
MALPADYKHEIEILEREVLQNKPTDVLQFCANHFHRRLESQRHEFLLGAQHSTSKTMAEN
NFPGSNPFHHIQQPGMQRLEEEDEMDTFASPTAASFPNNAMNRDASPFAANANPFGAGSA
NSVSSPFAASQSSDPSAQQSDGSFGGFNFGFGGAQNTNSRDQKDVPQNFPNNYNMGRRVS
VSAEVLAPSGTDDSDWKPPTYPKTQEQLNRLRTSVSRNFLFSHLDDDQTEQVLGALQERK
IPAKDVKVIAQGDVGDYFYVVETGSFDIYVSSTGKIEPGMNGMGNKVASCGPGTSFGELA
LMYNAPRAATVNSAEPSVIWQLDRITFRRILMDSAFQRRRMYESFLDSVPLLNTLTAYER
SKIADALETQKMPAGSTIIREGDVGDHFYMLESGTAAVYKSGIEQSLKQYNKGDYFGELA
LLDDKPRAASVVAETDIKVAMLGKNGFQRLLGPVASIMRRDDPTKSDGGSVQTSSSSAGP
FSDSVNPFSSS
Download sequence
Identical sequences A0A1A7MM14

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]