SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7VTX4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  A0A1A7VTX4
Domain Number - Region: 84-125
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00785
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A7VTX4
Sequence length 263
Comment (tr|A0A1A7VTX4|A0A1A7VTX4_PLAKH) Uncharacterized protein {ECO:0000313|EMBL:SBO25539.1} KW=Complete proteome OX=5851 OS=Plasmodium knowlesi (strain H). GN=PKNA1_C2_0602300 OC=Plasmodiidae; Plasmodium; Plasmodium (Plasmodium).
Sequence
MVKIGKKLKGFDEGINRYDTHIGGDASQEKDTQVRNGVEGGTGRDSITLLGDHVGEHLST
EAKNRRGSIEDTLPNNCDSNVDQEDINAYVERTDTSTLLTLLLYKVLITRPKNVIDYITD
ELAILINHEPEIKETKKNRDIGRDSPNSTPFQDNMDGQPNPLGEGDFSLKYTPTELIKHK
TFLGESFITLDDLFDAVKQIKIENCDKVYFNSLLKILRPFKNAENKRILRKENVQPNECI
PLNWALYLTTTFYNNCIGGASGV
Download sequence
Identical sequences A0A1A7VTX4 B3L1U0
XP_002261696.1.91479 PKH_060220 gi|193808156|emb|CAQ38859.1| gi|221053897|ref|XP_002261696.1| 5850.PKH_060220

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]