SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7WNQ8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7WNQ8
Domain Number 1 Region: 251-292
Classification Level Classification E-value
Superfamily Frizzled cysteine-rich domain 0.0000759
Family Frizzled cysteine-rich domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A7WNQ8
Sequence length 298
Comment (tr|A0A1A7WNQ8|A0A1A7WNQ8_9TELE) Glypican 6, like {ECO:0000313|EMBL:SBP07388.1} OX=60296 OS=Aphyosemion striatum. GN=GPC6L OC=Aphyosemion.
Sequence
MDTRLLVLLCTVVALSGTRSPAAAAGRSCADTRQVYSEKGYSTNTAPVTQISGEHLRLCP
QDYTCCSSQMEETLSLQSERDFLKAIEDNSQFLLTTFTQRHRRFDEFFRELTDLSEKSMN
QMFTKTYGLLFTQNAHVFQELFVELRRYYSGGSVSLSEVLSDFWSRLVERVFSLINPQYQ
FSEDYLECVSKHAEQLQPFGDVPRKLRVQVSRAFIAARSLSQGLATGRDIVNKASKLTAD
SECVRGLMRQWYCPLCRGVPFLRPCRSLCLNVMKGCLANQADLDTEWNNFIDALYLVS
Download sequence
Identical sequences A0A1A7WNQ8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]