SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7XTA2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7XTA2
Domain Number 1 Region: 203-310
Classification Level Classification E-value
Superfamily PDZ domain-like 5.13e-31
Family PDZ domain 0.0000447
Further Details:      
 
Domain Number 2 Region: 4-62
Classification Level Classification E-value
Superfamily L27 domain 2.35e-20
Family L27 domain 0.0000975
Further Details:      
 
Domain Number 3 Region: 313-351
Classification Level Classification E-value
Superfamily PDZ domain-like 0.0000409
Family PDZ domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A7XTA2
Sequence length 351
Comment (tr|A0A1A7XTA2|A0A1A7XTA2_9TELE) Discs, largehomolog 1, like {ECO:0000313|EMBL:SBP21347.1} OX=60296 OS=Aphyosemion striatum. GN=DLG1L OC=Aphyosemion.
Sequence
MPVRKRDAQRALLLLEEYRNKLNHTEDRQLRHSIQRVIDIFQSNLFQALIDIQEFYEVTL
SDSQRWAESSKGADPMAPVHLWDFPSLQSTTVTSETLPSLSTSIEKYRHHDEDSSPQEHS
SPQLTEEAGGPELVQVAEKNLSQIENVHGYVTHAHISPMKQAEVAPPSSPIIPVIPISPI
PAETTAMPPASQANPPPVVVNADSLDTPPYVNGTEADYEYEEITLERGNSGLGFSIAGGT
DNPHIGEDPSIFITKVIPGGAAAQDGRLRVNDVILRVNEVDVRDVTHSRAVEALKEAGSL
VRLYIRRRKPVSEKVMEIKLVKGPKGLGFSIAGGVGNQHIPGDNSIYVTKI
Download sequence
Identical sequences A0A1A7XTA2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]