SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7ZH06 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7ZH06
Domain Number 1 Region: 131-320
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.78e-33
Family Nucleotide and nucleoside kinases 0.0000473
Further Details:      
 
Domain Number 2 Region: 376-561
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.95e-28
Family Nucleotide and nucleoside kinases 0.0000178
Further Details:      
 
Domain Number 3 Region: 5-47
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000107
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A7ZH06
Sequence length 566
Comment (tr|A0A1A7ZH06|A0A1A7ZH06_NOTFU) Adenylate kinase 5 {ECO:0000313|EMBL:SBP41753.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=AK5 OC=Nothobranchius.
Sequence
MMNTNDAKEYLARQEIPQLFESLLTGLMYYRPDDPIEYLEGCLKKVRELGGTDKVRWDTF
VGQEKKSLPPLNGGQSRRSLFRNVLPDSPNFPYRRYDRLPPINQFSIESDSDLSETAELI
EEYEVFDPSRPRPKVILVIGGPGSGKGTQSLKIAERYGFHYMSVGELLRKKMIHNATSNR
KWSLIAKIITNGELAPQETTITEIKQKIMKIPDANGIVIDGFPRDVGQALSFEDQICTPD
LVVFLACTNHRLKERLQKRAEQQGRPDDNPKAIDRRLTNFKQNTIPLVKYFQERGLIVTL
DADRDEEEVFCDISMTLDNKLFDPKEPAAGPSELDLSLLGETSSLSEAACKKEELEEDEE
EIGNAEGTTESCCTEQSKPKVIFMMGGPGSGKALQSERMEERYGLRRVTLSDLLCSELQH
HSERGRNLRDILERGEKLPEDTLLELLCDSVASSVQRGKGLVVSGFPRDLKQVEEYEAKM
GEPNVVLLLSCSPETMSSRLQHRGRSLSASDSENILHRRVESFFSDSQVVTSHYERKMLL
HTIDAERSPNEVFAQICQAMESSSSF
Download sequence
Identical sequences A0A1A7ZH06
XP_015811660.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]