SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7ZHQ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7ZHQ6
Domain Number 1 Region: 1-41
Classification Level Classification E-value
Superfamily Interleukin 8-like chemokines 0.000000000236
Family Interleukin 8-like chemokines 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A7ZHQ6
Sequence length 72
Comment (tr|A0A1A7ZHQ6|A0A1A7ZHQ6_NOTFU) Uncharacterized protein {ECO:0000313|EMBL:SBP41595.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=Nfu_g_1_009519 OC=Nothobranchius.
Sequence
KMIVEVRVLKPRPYCSKCEVIVTLKDKRSKCLDPESQFTKFVLGADQKTCAKMSTAISKT
ATAASTTAVTSS
Download sequence
Identical sequences A0A1A7ZHQ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]