SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A7ZS37 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A7ZS37
Domain Number 1 Region: 36-74
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000000497
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A7ZS37
Sequence length 89
Comment (tr|A0A1A7ZS37|A0A1A7ZS37_NOTFU) Regulatory subunit of type II PKA R-subunit (RIIa) domain containing 1 {ECO:0000313|EMBL:SBP45579.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=RIIAD1 OC=Nothobranchius.
Sequence
MEDKGVSQRPCFGELSDEQKEKLRQFKIKTRLDNERYLRAHPELGGMIGAFISKLILNKP
TNIREFAADHFTTLDAHAAPSTERSDSAE
Download sequence
Identical sequences A0A1A7ZS37 A0A1A8CWR5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]