SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8APM2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8APM2
Domain Number 1 Region: 300-334
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000602
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8APM2
Sequence length 351
Comment (tr|A0A1A8APM2|A0A1A8APM2_NOTFU) Chromosome 2 open reading frame 62 {ECO:0000313|EMBL:SBP56180.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=C6H2ORF62 OC=Nothobranchius.
Sequence
MEASDANVRAKSGTEEEKHLTASDEAITFMSSIEPAELQRCVFSESLAVMSENGSDLGTF
SVSVEFSRRAQQPCVLLHAQSQGVIDGCPCGTTVTAYISVELEVLEEDYHEYVELEGHSV
DKKCYLVQHDGQMVISKVTTVGHEETKESVCYPMTALRGLVTEGSSLLMMRLIALRKKLP
KNMSFVSLDQRLQTSHTTFNELGLKQLEVGGEVLEGFGVQRTVHCGEDTPAAWQCYLLDD
GHLVSRMQVGSPVTMKLVQLPPKTEKNFEKIPLAWEEDLQMVSEFSDRKEELKADHTSYL
RQHPEIRALLSDFLLSLLLRKPNNVFQFAREYFLPFAPRRSPQPNLNAQAQ
Download sequence
Identical sequences A0A1A8APM2
XP_015812950.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]