SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8CQB7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8CQB7
Domain Number 1 Region: 34-205
Classification Level Classification E-value
Superfamily MIR domain 2.49e-58
Family MIR domain 0.000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8CQB7
Sequence length 226
Comment (tr|A0A1A8CQB7|A0A1A8CQB7_9TELE) Stromal cell-derived factor 2 {ECO:0000313|EMBL:SBP80916.1} OX=1051664 OS=Nothobranchius kadleci. GN=SDF2 OC=Nothobranchius.
Sequence
MANLNLDIFDHFLPAFLLILFCIFGLSAGTELSFVTCGSVIKLLNTRHNVRLHSHDVRYG
SGSGQQSVTGVSVVEDSNSYWSIRGTRDSSCHRGSPVTCGQTIRLTHVNTGRNLHSHYFA
SPLSSNQEVSAFGEEGEGDHLDEWTVECGGSVWRREEAVRFRHKATDMLLSVTGEQYGRP
IHGQTEVHAMQSASQHSLWKAMEGIFIKPSESPAGSRDYGHAHTEF
Download sequence
Identical sequences A0A1A8CQB7 A0A1A8JMB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]