SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8CR63 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8CR63
Domain Number 1 Region: 62-172
Classification Level Classification E-value
Superfamily GINS helical bundle-like 4.03e-37
Family PSF2 C-terminal domain-like 0.00000425
Further Details:      
 
Domain Number 2 Region: 1-60
Classification Level Classification E-value
Superfamily PriA/YqbF domain 7.19e-22
Family PSF2 N-terminal domain-like 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8CR63
Sequence length 186
Comment (tr|A0A1A8CR63|A0A1A8CR63_9TELE) DNA replication complex GINS protein PSF2 {ECO:0000256|PIRNR:PIRNR028998} OX=1051664 OS=Nothobranchius kadleci. GN=GINS2 OC=Nothobranchius.
Sequence
MDPSEVEFLAEKELVKIIPNFSLDKIFLIGGDLGPFNPGLSVDVPLWLALNLKQRQKCRI
LPPDWMDVEKLEEMRALERKEDAFTPVPSLYYMEITKLLLNHASDNIPKADEIRTLVKDI
WDTRIAKLRLSADSFINQQEAHAQLDNLTLMEINTTREFLLDSLNFMFKLRSNLQPGSSK
GQLTDY
Download sequence
Identical sequences A0A1A8B8G7 A0A1A8CR63 A0A1A8PV84 A0A1A8QQA5
XP_015808397.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]