SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8E0G4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8E0G4
Domain Number 1 Region: 27-78
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000033
Family TNF receptor-like 0.0019
Further Details:      
 
Domain Number 2 Region: 77-150
Classification Level Classification E-value
Superfamily TNF receptor-like 0.0000000942
Family TNF receptor-like 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8E0G4
Sequence length 183
Comment (tr|A0A1A8E0G4|A0A1A8E0G4_9TELE) Uncharacterized protein {ECO:0000313|EMBL:SBQ39433.1} OX=1051664 OS=Nothobranchius kadleci. GN=TNFRSF9 OC=Nothobranchius.
Sequence
MVLIQWLMGLALLTQSCMSSLDQAEVGCKTWRQEGDNVCCDECHPGNRLVRQCGPRPKQL
CTPCETGTYTHNLMTRRCDRCTQCVGAQVHLEDCTNQSDTRCGCKDGLTCGDGKCSFCVE
KCAKGSEPTDDRSCRPCPRGTFNNMNHSTCKPWSTKCPGPNQEIVAEGNAFSDIQCQVMV
PSE
Download sequence
Identical sequences A0A1A8E0G4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]