SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8E2M0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8E2M0
Domain Number 1 Region: 1-48
Classification Level Classification E-value
Superfamily SAM/Pointed domain 1.1e-16
Family Variant SAM domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8E2M0
Sequence length 98
Comment (tr|A0A1A8E2M0|A0A1A8E2M0_9TELE) Uncharacterized protein {ECO:0000313|EMBL:SBQ39731.1} OX=1051664 OS=Nothobranchius kadleci. GN=Nfu_g_1_015722 OC=Nothobranchius.
Sequence
YVQLFKDCRFPIDIKTAKNDHRFLDEDSLDSLCRRLITLNKCTEMRLELWRSKHKGDDWD
EEDSCAISPNWTYDQQTRQWRRLDSNDEVLHLSACPAG
Download sequence
Identical sequences A0A1A8E2M0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]