SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8F2H5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8F2H5
Domain Number 1 Region: 150-280
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.44e-33
Family cAMP-binding domain 0.000000979
Further Details:      
 
Domain Number 2 Region: 284-420
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.67e-32
Family cAMP-binding domain 0.00000256
Further Details:      
 
Domain Number 3 Region: 30-70
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000275
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8F2H5
Sequence length 432
Comment (tr|A0A1A8F2H5|A0A1A8F2H5_9TELE) Protein kinase, cAMP-dependent, regulatory, type II, beta {ECO:0000313|EMBL:SBQ52966.1} OX=1143690 OS=Nothobranchius korthausae. GN=PRKAR2B OC=Nothobranchius.
Sequence
ARASLLLLPFILDLQQIGFVHIHRLKTGMSIEIPEGLTELLQSFTVEVLRNQPRDLLEFA
LQYFTQLKDSETKEASFGNEQNSAPRSGKAVNFIDEAMQIDSENGEDDDDDDEEFTAPVI
NRFIRRASVCAEAFNPDEDDEDKEPRVTYPKTDEQRYRLQEACKDILLFKNLDPEQMSQV
LDAMFEKFCTEGEHIIDQDDDGDNFYVIESGTFNIFVKVDNAEKLVGCYDNRGSFGELAL
MYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIETLPLLTSLEVSERM
KVVDVLTTRVYNDSQQIIAQGDLADCFYIVESGQVRITMKRSRTKTDQEEEEVDIATCTR
GQYFGELALVTNKPRAASAYAVGSVKCLVMDVKAFERLLGPCMDIMKRNIANYEEQLVTL
FGSSPEIEQQNA
Download sequence
Identical sequences A0A1A8F2H5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]