SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8FFF2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8FFF2
Domain Number 1 Region: 23-209
Classification Level Classification E-value
Superfamily eIF4e-like 1.7e-75
Family Translation initiation factor eIF4e 0.0000000231
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8FFF2
Sequence length 214
Comment (tr|A0A1A8FFF2|A0A1A8FFF2_9TELE) Eukaryotic translation initiation factor 4eb {ECO:0000313|EMBL:SBQ58130.1} OX=1143690 OS=Nothobranchius korthausae. GN=EIF4EB OC=Nothobranchius.
Sequence
TAEPETSPSPTLPDEEGVEESGQEIVSPEAYIKHPLQNRWSLWFFKNDKSKTWQANLRLI
STFDTVEDFWALYNHIQLSSNLLSGCDYSLFKDGIEPMWEDERNKRGGRWLITLNKQQRR
QDLDRFWLETLLCLVGEAFDDYSDDVCGAVVNVRNKGDKIAVWTADFENREAVTHIGRVY
KERLGLPLKMTIGYQSHTDTATKSGSTTKNKFVV
Download sequence
Identical sequences A0A1A8FFF2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]