SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8GME6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8GME6
Domain Number 1 Region: 62-175
Classification Level Classification E-value
Superfamily Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 2.22e-20
Family Wiscott-Aldrich syndrome protein, WASP, C-terminal domain 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8GME6
Sequence length 188
Comment (tr|A0A1A8GME6|A0A1A8GME6_9TELE) Wiskott-Aldrich syndrome-like a {ECO:0000313|EMBL:SBQ72322.1} OX=1143690 OS=Nothobranchius korthausae. GN=WASLA OC=Nothobranchius.
Sequence
PPPPPPPPTRGGHHPPPPPHHHNQQPPPPPPSSPSVTPPAPPPPPPPPAHQSPADTAPAP
PPPPPGPPPPQELDGVSGDLPHSPSPGGKSALLEQIRGGAQLKKVEQNHRVPASSSGRDA
LLDQIRQGIQLKTVSDPESGPPTPAPATGIVGALMEVMQKRSKAIHSSDDDDDDDEEEDF
EDDDEWDD
Download sequence
Identical sequences A0A1A8GME6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]