SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8GR92 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8GR92
Domain Number 1 Region: 300-334
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000392
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8GR92
Sequence length 351
Comment (tr|A0A1A8GR92|A0A1A8GR92_9TELE) Chromosome 2 open reading frame 62 {ECO:0000313|EMBL:SBQ74431.1} OX=1143690 OS=Nothobranchius korthausae. GN=C6H2ORF62 OC=Nothobranchius.
Sequence
MEASDANVRAKSGTEEQKHLTASDEAITFMSSIEPAELQRCVFSESLAVMSENGSDLGTF
SVSVEFSRRAQQPCVLLHAQSQGVIDGCPCGTTVTAYISVDLEVLEEDYHEYVELEGHSV
DKKCYLVQHDGQMVISRVTAVGQEETKESVCYPMNALRGLVTEGSSLLMMRLMALRKKLP
KNMSFVSLDQRLQTSHTTFNELGLKQLEVGGEVLEGFGVQRTVHCGEDIPVAWQCYLLDD
GHLVSRMQVGSPVTMKLVQLPPKTEKNFQKIPLAWEEDLQMVSEFSDRKEELKADHTSYL
RQHPEIRALLSDFLLSLLLRKPNDVFQFAREYFLPFAPRRSPQPNLNAQAQ
Download sequence
Identical sequences A0A1A8GR92

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]