SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8H064 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8H064
Domain Number 1 Region: 94-275
Classification Level Classification E-value
Superfamily EF-hand 1.04e-45
Family Penta-EF-hand proteins 0.00000685
Further Details:      
 
Domain Number 2 Region: 1-89
Classification Level Classification E-value
Superfamily Calpain large subunit, middle domain (domain III) 1.31e-27
Family Calpain large subunit, middle domain (domain III) 0.0000187
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8H064
Sequence length 276
Comment (tr|A0A1A8H064|A0A1A8H064_9TELE) Uncharacterized protein {ECO:0000313|EMBL:SBQ76654.1} OX=1143690 OS=Nothobranchius korthausae. GN=CAPN2 OC=Nothobranchius.
Sequence
DMHTIGFAIYEVPQQFHGQRDVHLDKNFFLSHAQKAKSETFINLREVSNRFKLPPGEYLI
VPSTFDPHLNGDFCIRVFSEKQAETVHCDDPVSATLTEDLVSDQDVDSGFKNLFTKLAGP
DMEISASELQNIMNKIVSKRTDIKTDGFSLDTCRVMVNLMDSSGNGKLGLGEFATLWKKV
QNYLSIYKKDDSDNSGTMSTTEIRVAFKDAGFSLNNTIYQQVVARYSDPDMTIDFDNFVS
CLMRMELMFRIFYKLDTNSSGSIELDFQQWLTFAMI
Download sequence
Identical sequences A0A1A8H064

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]