SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8HBC2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8HBC2
Domain Number 1 Region: 155-223
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.35e-29
Family AN1-like Zinc finger 0.0000425
Further Details:      
 
Domain Number 2 Region: 13-54
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000699
Family A20-like zinc finger 0.0091
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8HBC2
Sequence length 228
Comment (tr|A0A1A8HBC2|A0A1A8HBC2_9TELE) Zinc finger, AN1-type domain 5b {ECO:0000313|EMBL:SBQ80030.1} OX=1143690 OS=Nothobranchius korthausae. GN=ZFAND5B OC=Nothobranchius.
Sequence
MAQETNQSPVPMLCATGCGFYGNPRTNGMCSVCHKEHLSRQNNGGVGSLNTMSSSGSSTA
EDSAIQRLEATLNNAAAAAVAAAEEAADAAAASDAAAGALSLSGISSASSVTKQMTEMSL
SEENLASASKAQVSDPGVSQPIVLVSQPSTAGSEEVQAPEPLKPKKNRCFMCRKKIGLTG
FDCRCGNLFCGIHRYSDKHNCPYDYKADAAAKIRKENPMIVAEKIQRI
Download sequence
Identical sequences A0A1A8HBC2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]