SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8IIG2 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8IIG2
Domain Number 1 Region: 115-236
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.56e-30
Family cAMP-binding domain 0.0000022
Further Details:      
 
Domain Number 2 Region: 2-43
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000301
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8IIG2
Sequence length 241
Comment (tr|A0A1A8IIG2|A0A1A8IIG2_NOTKU) Protein kinase, cAMP-dependent, regulatory, type II, alpha A {ECO:0000313|EMBL:SBQ96180.1} OX=321403 OS=Nothobranchius kuhntae (Beira killifish). GN=PRKAR2AA OC=Nothobranchius.
Sequence
MSIEIPVGLTELLQGYTVEVLRQRPSDLVDFAVQYFTRLRDSRSQDGSSTGGKPGKGVMF
DGEPMQTESNGDDEEDDDSDFEPPPPSGFNRRVSVCAEQIDLDDDEEDTEPRVVHPKTDE
QRCRLQEACRDILLFKTLDQEQFSQVLDAMFELNVQPQEHVIDQGDDGDNFYVIDRGLYD
IVVSGKCVGQYNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKR
K
Download sequence
Identical sequences A0A1A8C832 A0A1A8IIG2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]