SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8IQ50 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8IQ50
Domain Number 1 Region: 16-221
Classification Level Classification E-value
Superfamily Ankyrin repeat 7.96e-57
Family Ankyrin repeat 0.00012
Further Details:      
 
Domain Number 2 Region: 237-277
Classification Level Classification E-value
Superfamily SOCS box-like 0.0000628
Family SOCS box-like 0.0099
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8IQ50
Sequence length 278
Comment (tr|A0A1A8IQ50|A0A1A8IQ50_NOTKU) Ankyrin repeat and SOCS box-containing 13a, tandem duplicate 2 {ECO:0000313|EMBL:SBQ99432.1} OX=321403 OS=Nothobranchius kuhntae (Beira killifish). GN=ASB13A.2 OC=Nothobranchius.
Sequence
MESSHSYYFGDIGCWAERTEVHKAASLGQTSHLQHLIQGGASVNVVAVDSITPLHEACLQ
GQAQCVRLLLDAGAQVDARNVDGSTPLCDACSSGSLECVKLLLEHGAKANPALTSRTASP
LHEACMGGNSDCVRLLITMGACLEAYDLYYGTPLHVACVNERTDCVKVLLNAGAKVNAAR
LHETPLHHAAKAMRHDMVELLVEFGANIYARDQHNRKPVDYTTPGSLSATCLEFYETTPM
SLQQLSRLAVRRTLGTTALKVIAQLDVPKLIISYLCYQ
Download sequence
Identical sequences A0A1A8IQ50

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]