SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8JJ66 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8JJ66
Domain Number 1 Region: 10-51
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000191
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8JJ66
Sequence length 234
Comment (tr|A0A1A8JJ66|A0A1A8JJ66_NOTKU) Ropporin 1-like {ECO:0000313|EMBL:SBR09863.1} OX=321403 OS=Nothobranchius kuhntae (Beira killifish). GN=ROPN1L OC=Nothobranchius.
Sequence
MPLPDVLYCSQQIRIPPELPDILKNFTKAAIRTQPKDVLVWSAAYFHALADGDTLPVKER
LEMNVATQKTDTGLTPGLLKILHKQLSPKETCSKEELERTWKGLCLPVEQLESMLSLGSF
ESEITWMEFFALGCSALGANLQSSLKFACEILTNDEEGGAARIPFDTFVQIYTYLAHLDG
VVSQSHIQTFLKSLQPQVELQHGMIKPLDFIHRQAMDSAPSGSSGSSTTNPGAE
Download sequence
Identical sequences A0A1A8JJ66

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]