SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8KZ79 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8KZ79
Domain Number 1 Region: 109-152
Classification Level Classification E-value
Superfamily DEATH domain 0.00000353
Family DEATH effector domain, DED 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8KZ79
Sequence length 252
Comment (tr|A0A1A8KZ79|A0A1A8KZ79_NOTKU) Death effector domain containing 2 {ECO:0000313|EMBL:SBR36954.1} OX=321403 OS=Nothobranchius kuhntae (Beira killifish). GN=DEDD2 OC=Nothobranchius.
Sequence
MATVHFPGPTNRDSLYWDETECLNYYGMLSLHEIFEIVGCQLTETDIEVLSFLLNESYSA
PHPLDPVGWTIEPAEDDPEDLGLAPSPPLLKAWGRIKPKASQPSSVDIKPKSGVGLLLEL
ERRGYLCDGNLEPLLQLLRVLTRHDLLPLVSHKRRRTVSPERVGQRYETNSTELVFGLQH
TCRQTEIPFSSFTNPFTTDISSPLAGSSTRRQRRRRGYGWSRRSKKTTRPVQPLPPPAPQ
KVSCDIRLRVRA
Download sequence
Identical sequences A0A1A8KZ79

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]