SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8LAV3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8LAV3
Domain Number 1 Region: 48-134
Classification Level Classification E-value
Superfamily Thyroglobulin type-1 domain 1.7e-24
Family Thyroglobulin type-1 domain 0.0000194
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8LAV3
Sequence length 141
Comment (tr|A0A1A8LAV3|A0A1A8LAV3_9TELE) Insulin-like growth factor binding protein 4 {ECO:0000313|EMBL:SBR41014.1} OX=704102 OS=Nothobranchius pienaari. GN=IGFBP4 OC=Nothobranchius.
Sequence
NSVDRQEEIILEHPNISNIRCSPQDKRCIQKNMARLKSINPRSNSARDEAKLVLAPCRAE
LQRALDRLASNSRTHDDLFTIPIPNCDRNGDFHPKQCHPARDGHRGKCWCVDPKTGLRMP
GPLELRGELDCHQLMAATLRD
Download sequence
Identical sequences A0A1A8LAV3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]