SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8N7C7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8N7C7
Domain Number 1 Region: 118-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-34
Family cAMP-binding domain 0.00000094
Further Details:      
 
Domain Number 2 Region: 247-371
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.17e-32
Family cAMP-binding domain 0.000000866
Further Details:      
 
Domain Number 3 Region: 14-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.54e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8N7C7
Sequence length 380
Comment (tr|A0A1A8N7C7|A0A1A8N7C7_9TELE) Protein kinase, cAMP-dependent, regulatory, type I, beta {ECO:0000313|EMBL:SBR64767.1} OX=451742 OS=Nothobranchius rachovii (bluefin notho). GN=PRKAR1B OC=Nothobranchius.
Sequence
MATSSSTLEEDESLKGCEIFVQKHNIQQILKECIVNLCIAKPERPMKFLREHFEKLEKEE
CKQIMARQKSNSQSDSHDDEVSPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKD
YKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGE
VDVYVNGEWVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLR
KRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGEPGDDFFIITEGIAS
VLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGP
CSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences A0A1A7YI28 A0A1A8FBF4 A0A1A8LXE0 A0A1A8N7C7 A0A1A8UF58
XP_015801087.1.37898 XP_017291437.1.84151 XP_020788289.1.12261

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]