SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8N9X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8N9X0
Domain Number 1 Region: 147-181
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000249
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8N9X0
Sequence length 198
Comment (tr|A0A1A8N9X0|A0A1A8N9X0_9TELE) Chromosome 2 open reading frame 62 {ECO:0000313|EMBL:SBR65654.1} OX=704102 OS=Nothobranchius pienaari. GN=C6H2ORF62 OC=Nothobranchius.
Sequence
MTVLRGLVTEGSSLLMMRLISLRKKLPKNMSFVSLDQRLQTSHTTYNELGLKQLEVGGEV
LEGFGVQRTVHCGKDTPAAWQCYLLDDGHLVSRMQVGSPVTMKLVQLPPKTEKNFEKIPL
AWEEDLQMVSEFSDRKEELEADHTSYLRQHPEIRALLSDFLLSLLLRKPNNVFQFAREYF
LPFAPRRSPQPNLNAQAQ
Download sequence
Identical sequences A0A1A8N9X0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]