SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8PFS5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8PFS5
Domain Number 1 Region: 87-182
Classification Level Classification E-value
Superfamily PDZ domain-like 1.29e-29
Family PDZ domain 0.011
Further Details:      
 
Domain Number 2 Region: 8-64
Classification Level Classification E-value
Superfamily L27 domain 2.83e-22
Family L27 domain 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8PFS5
Sequence length 217
Comment (tr|A0A1A8PFS5|A0A1A8PFS5_9TELE) Protein lin-7 homolog {ECO:0000256|PIRNR:PIRNR038039} OX=451742 OS=Nothobranchius rachovii (bluefin notho). GN=LIN7A OC=Nothobranchius.
Sequence
MATVVQPLTLERDVARAIELLEKLQESGDVPGHKLQSLKKVLQSEFCTAIREVYQYMHET
ITVNGCPDYQARATAKATVAAFAASEGHSHPRVVELPKTEEGLGFNVMGGKEQNSPIYIS
RIIPGGVAERHGGLKRGDQLLSVNGVSVEGEHHEKAVELLKAAKDSVKLVVRYTPKVLEE
MEARFEKLRTARRRQQQQLLMQQQQQQNLPSQQNHMS
Download sequence
Identical sequences A0A1A8HAE8 A0A1A8L6W9 A0A1A8PFS5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]