SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8PKK6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8PKK6
Domain Number 1 Region: 20-68
Classification Level Classification E-value
Superfamily GLA-domain 7.91e-20
Family GLA-domain 0.00054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8PKK6
Sequence length 211
Comment (tr|A0A1A8PKK6|A0A1A8PKK6_9TELE) Proline rich Gla (G-carboxyglutamic acid) 1 {ECO:0000313|EMBL:SBR81811.1} OX=704102 OS=Nothobranchius pienaari. GN=PRRG1 OC=Nothobranchius.
Sequence
MGSVFLPASTANSLLKRLRRANFLLEEIKLGNIQRECREEVCTYEEAREAFENDEKTRRF
WEEYVRESSPPGGLNSVVGGAQSLYVVVPLVLVGLIIAAIAITAWRCHTRKRSQRSPSLG
HSHHNHVLSVVSMDQWGRDYHHGDQSELSIHSSPAYLGSEMTSGRGGVGDPPPSYEEAVG
HTDVQIETEPPPQYEDIMNTSSVRISGGQGK
Download sequence
Identical sequences A0A1A8PKK6 A0A1A8QHN4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]