SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8PPG5 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8PPG5
Domain Number 1 Region: 8-67
Classification Level Classification E-value
Superfamily PHM/PNGase F 0.0000000000303
Family Peptidylglycine alpha-hydroxylating monooxygenase, PHM 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8PPG5
Sequence length 67
Comment (tr|A0A1A8PPG5|A0A1A8PPG5_9TELE) Dopamine beta hydroxylase {ECO:0000313|EMBL:SBR83315.1} OX=451742 OS=Nothobranchius rachovii (bluefin notho). GN=DBH OC=Nothobranchius.
Sequence
TQAALPPGGIYIFASQLHTHLAGRGVRTVLVRGGVELEVVQDDQHFSAEYQPIRVLRKMV
NALQGDV
Download sequence
Identical sequences A0A1A8PPG5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]