SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8QBU1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8QBU1
Domain Number 1 Region: 35-136
Classification Level Classification E-value
Superfamily Cytochrome b5-like heme/steroid binding domain 7.07e-25
Family Steroid-binding domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8QBU1
Sequence length 202
Comment (tr|A0A1A8QBU1|A0A1A8QBU1_9TELE) Cytochrome b5 domain containing 2 {ECO:0000313|EMBL:SBR90971.1} OX=704102 OS=Nothobranchius pienaari. GN=CYB5D2 OC=Nothobranchius.
Sequence
MPSYALGAFLAVLFALWFVPRDWSRKSGTESSVDPPVRLLSRHELSLYDGEEGSRGLYLA
ILGQVFDVHKGHKHYGPGGAYHVMAGKDVSLAFITGDFTESGLTDDVSSLSPLQVVALFQ
WLAFYQREYLSVGVLIGQFYNESGQPTEALLEAEALLAEGQQLKALSESEKVRFPSCNSE
WSADRGARVWCSTKSGGVIRDW
Download sequence
Identical sequences A0A1A8QBU1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]