SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8QHJ1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8QHJ1
Domain Number 1 Region: 60-117
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 2.62e-16
Family AN1-like Zinc finger 0.0001
Further Details:      
 
Domain Number 2 Region: 5-46
Classification Level Classification E-value
Superfamily AN1-like Zinc finger 0.0000000000602
Family AN1-like Zinc finger 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8QHJ1
Sequence length 269
Comment (tr|A0A1A8QHJ1|A0A1A8QHJ1_9TELE) Zinc finger, AN1-type domain 1 {ECO:0000313|EMBL:SBR92877.1} OX=704102 OS=Nothobranchius pienaari. GN=ZFAND1 OC=Nothobranchius.
Sequence
MAEVDIGRHCQVDSCNIKDFLPFVCDCCSGVYCLEHRSREAHSCAQEPVKRELRTTGGSV
SYSCSFEGCKGKELLPVLCPHCEKHFCLAHRHQDDHNCEKLEVQKPRMAATKELVQKIVE
SKDGSKSKGCKGAKNAATAAKVALMKLKLHAVGDKGLPQTERTYFQVYLPKEAKERSQPM
FFSSKWSVGKVVDHAASLASLKNNNNVLTAKKLRLCHPHTGEAFRMDDTLLSLLAHTESP
LHNGGNVILEYLDNESSGLEDVSDYFTQT
Download sequence
Identical sequences A0A1A8QHJ1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]