SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8QHU8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8QHU8
Domain Number 1 Region: 21-162
Classification Level Classification E-value
Superfamily GINS helical bundle-like 1.99e-44
Family SLD5 N-terminal domain-like 0.00000167
Further Details:      
 
Domain Number 2 Region: 167-223
Classification Level Classification E-value
Superfamily PriA/YqbF domain 0.00000000000000216
Family SLD5 C-terminal domain-like 0.0000822
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A8QHU8
Sequence length 223
Comment (tr|A0A1A8QHU8|A0A1A8QHU8_9TELE) DNA replication complex GINS protein SLD5 {ECO:0000256|PIRNR:PIRNR007764} OX=704102 OS=Nothobranchius pienaari. GN=GINS4 OC=Nothobranchius.
Sequence
MSDALSEDGSDINQDDSQDVMTPAELIAKLEEAWLNEKFSPELLENKSEVVECVMEQLTH
MESNLQRVKKGDAKASFHRMEIDRIRFVLSSYLRSRLQKIEKFFPHVLEREKSRVEGQPS
LLSPEEFAFAKEYYTNTETYLKAVALKRMPLNLQTVDLLKAVPEPCLDSFVFLRVKEKQE
NILVEPETDDQREYIVDLEEGSQHLMRYRTVAPLVSSGAVQLI
Download sequence
Identical sequences A0A1A8QHU8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]