SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8U1D4 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8U1D4
Domain Number 1 Region: 1-62
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 7.41e-21
Family Calponin-homology domain, CH-domain 0.0000254
Further Details:      
 
Domain Number 2 Region: 121-176
Classification Level Classification E-value
Superfamily EB1 dimerisation domain-like 4.45e-18
Family EB1 dimerisation domain-like 0.0000985
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A8U1D4
Sequence length 182
Comment (tr|A0A1A8U1D4|A0A1A8U1D4_NOTFU) Microtubule-associated protein, RP/EB family, member 1b {ECO:0000313|EMBL:SBS40948.1} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=MAPRE1B OC=Nothobranchius.
Sequence
HEYIHNFKILQVGFKKMGVDKIIPVDKLVKGKFQDNFEFVQWFKKFFDANYDGKEYDPVA
ARQGQDAMAMPIPASSALNKPPKKALSQAPQRPPVAKVAPKLAPVSAKKPGMGGADEERV
ELLNEIEILKSTIQDMEKERDFYFGKLRNIELICQEKEGEGDPTLQRIIDILYATDVSFL
GS
Download sequence
Identical sequences A0A1A8CFH9 A0A1A8HR10 A0A1A8U1D4

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]