SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A8VCI7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A8VCI7
Domain Number 1 Region: 5-79
Classification Level Classification E-value
Superfamily Signal recognition particle alu RNA binding heterodimer, SRP9/14 2.2e-31
Family Signal recognition particle alu RNA binding heterodimer, SRP9/14 0.0000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1A8VCI7
Sequence length 86
Comment (tr|A0A1A8VCI7|A0A1A8VCI7_NOTFU) Signal recognition particle 9 kDa protein {ECO:0000256|PIRNR:PIRNR017029} OX=105023 OS=Nothobranchius furzeri (Turquoise killifish). GN=SRP9 OC=Nothobranchius.
Sequence
MPYYQVWEEFARAAEKLYLADPMKVRVVLKYRHCDGNLCIKVTDNAVCLQYKTDQAQDVK
KIEKLHGKLMRLMVSKETHSGAMETD
Download sequence
Identical sequences A0A1A8DU01 A0A1A8KCN1 A0A1A8QKB0 A0A1A8R3M7 A0A1A8VCI7
XP_015831025.1.37898

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]