SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9R5X0 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9R5X0
Domain Number 1 Region: 8-70
Classification Level Classification E-value
Superfamily WGR domain-like 0.00000000248
Family WGR domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A9R5X0
Sequence length 93
Comment (tr|A0A1A9R5X0|A0A1A9R5X0_9GAMM) Uncharacterized protein {ECO:0000313|EMBL:OAL60290.1} KW=Complete proteome OX=1805819 OS=Halomonas sp. ALS9. GN=A6R74_20705 OC=Halomonadaceae; Halomonas.
Sequence
MIVRWETNHDYVLVHIHQDMFGDWIFSRAWGQIGTQFGGLKHQLADTLDQAHMWLEDEAT
IQSSRGFRKVLEVADHTPEGQEAMRQLSLLDVM
Download sequence
Identical sequences A0A1A9R5X0
WP_064233941.1.83590

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]