SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9VSJ6 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9VSJ6
Domain Number 1 Region: 25-122
Classification Level Classification E-value
Superfamily Chemosensory protein Csp2 7.59e-41
Family Chemosensory protein Csp2 0.0000596
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A9VSJ6
Sequence length 123
Comment (tr|A0A1A9VSJ6|A0A1A9VSJ6_GLOAU) Chemosensory protein 4 {ECO:0000313|VectorBase:GAUT046063-PA} KW=Complete proteome; Reference proteome OX=7395 OS=Glossina austeni (Savannah tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MKSTFCCLALLVVCLSVIVTAQKSYTNKFDGVDVDSVLSNDRILTNYIKCLMEKGPCTPE
GRELKKLLPDALKSDCTKCTDVQKKNSQKVINYLRANRPGEWKLLLNKYDPSGDYRAKYE
KQA
Download sequence
Identical sequences A0A1A9VSJ6

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]