SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9WVW1 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9WVW1
Domain Number 1 Region: 249-322
Classification Level Classification E-value
Superfamily HR1 repeat 6.41e-19
Family HR1 repeat 0.00047
Further Details:      
 
Domain Number 2 Region: 117-197
Classification Level Classification E-value
Superfamily HR1 repeat 1.96e-17
Family HR1 repeat 0.001
Further Details:      
 
Domain Number 3 Region: 357-403
Classification Level Classification E-value
Superfamily HR1 repeat 0.0000000000068
Family HR1 repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1A9WVW1
Sequence length 405
Comment (tr|A0A1A9WVW1|A0A1A9WVW1_9MUSC) Uncharacterized protein {ECO:0000313|VectorBase:GBRI034409-PA} KW=Complete proteome; Reference proteome OX=37001 OS=Glossina brevipalpis. GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MWFRGYVVSRLCGIAVKRYNGYVVSRLCGMAVGDIAVMWYRGYVVWRWYRGMWYGGYVVS
RYVVSRYVVLRLSGITVKRYNGYVVSRLSGITVMWNRGTWFRGYVGDYIKHPVLYELSHK
YGFTDNLPESALPDRLEEIKEAIRREIRKELKIKEGAEKLREVAKDRRSLNDVATIVKKS
NSKIAELKSELQELESQILLTQGNTAVTNNGRDIFLPNALSQGSLGNNSQSNDRNNGGSG
GDGLISGGHEQLSANDKLMLSLEKQLNIEMKVKNGAENMIQSLQSGHYGRDKKLLAEAQQ
MLTDSKAKIEFLRLRILKVKQNKEHANKLAAQIIANADENGSSGVGGIGGLMPQRLETSL
EERIEELRHRLRIEAAVVDGAKNVIRILQNNKVPDKKALQEVRVN
Download sequence
Identical sequences A0A1A9WVW1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]