SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9WXA8 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9WXA8
Domain Number 1 Region: 14-56
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000112
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A9WXA8
Sequence length 333
Comment (tr|A0A1A9WXA8|A0A1A9WXA8_9MUSC) Uncharacterized protein {ECO:0000313|VectorBase:GBRI035851-PA} KW=Complete proteome; Reference proteome OX=37001 OS=Glossina brevipalpis. GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MLYLIQRGKVRSQVINVPEGLPEVLSDIAREVLRCQPTTECLCQFIVDYMHSVISAREKA
RVAKSVIDRTLCAVNEVISDMCVCDISKEKSELICTVMEDCFRRFLAKRHCELGKEEVLL
KFNEIDILDELIMKCKFSEIEIKTSRPIIEAASQRLMETYMMAENNTEAIDALYEYFRER
EQKRAVERKRQSAAVKIQAWYRGSHLRKSLHEDRALETQQPQQESSETEQMILVRHMAAR
KIQQFFRNRLSSIRDKHSMLQNFPEICEPKSKLSMTVRPSGYDLHTEENDYGDNLTAENI
PQHFQEANIPDMTEISNLMGASKEIVDGEEFDA
Download sequence
Identical sequences A0A1A9WXA8

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]