SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1A9Y960 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1A9Y960
Domain Number 1 Region: 48-137
Classification Level Classification E-value
Superfamily Insect pheromone/odorant-binding proteins 0.0000000798
Family Insect pheromone/odorant-binding proteins 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1A9Y960
Sequence length 163
Comment (tr|A0A1A9Y960|A0A1A9Y960_GLOFF) Uncharacterized protein {ECO:0000313|VectorBase:GFUI035804-PA} KW=Complete proteome; Reference proteome OX=201502 OS=Glossina fuscipes fuscipes (Riverine tsetse fly). GN= OC=Hippoboscoidea; Glossinidae; Glossina.
Sequence
MNNNLNISPVIRLAMQGSQRRGDVVFFSIVYMSSSYSSSENWKQPTPQTVVQVAQKCLRL
QNGLNIETLHDDPKQVRCFFENLSLWDKYNGFKAERLGYVFNKRQMMNEILVAVNYCDDK
TRQDDANKWAFEAYSCFAVGPIGNWTNLFITNAYKKVLKDKGL
Download sequence
Identical sequences A0A1A9Y960

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]