SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B0CDD7 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B0CDD7
Domain Number 1 Region: 150-305
Classification Level Classification E-value
Superfamily C-terminal domain of adenylylcyclase associated protein 3.27e-62
Family C-terminal domain of adenylylcyclase associated protein 0.00000388
Further Details:      
 
Domain Number 2 Region: 2-70
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 1.01e-24
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.00092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) A0A1B0CDD7
Sequence length 305
Comment (tr|A0A1B0CDD7|A0A1B0CDD7_LUTLO) Adenylyl cyclase-associated protein {ECO:0000256|RuleBase:RU000647} KW=Complete proteome; Reference proteome OX=7200 OS=Lutzomyia longipalpis (Sand fly). GN= OC=Psychodidae; Lutzomyia; Lutzomyia.
Sequence
GQFYTNRVLKEWREKDATHVEWTRAWIQTLTNLQQYIKQHHTTGLVWSGKGAVPSGGCPP
PPPPGIPPPPPVIPLGDLSLNNSGDDRSALFAEINRGEDITKNLKKVSADMQTHKNPALR
SGPAPFKAPISAPKSAGAPKPTTDVANKAPVFSRDGKKWLIEYQKSNPGLAIDNAEMNNV
AYMFRCQDSTLTVKGKINSIVIDSCKKCSILFDSLVSSIEFVNCQSVQMQVLGKVPTISI
DKTDGCQMYLSDQSMDVEIISSKSSEMNVLIPKGNGDYAEQPIPEQFKTTIKGKSLNTVC
VESLG
Download sequence
Identical sequences A0A1B0CDD7

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]