SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B0CGB3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B0CGB3
Domain Number 1 Region: 6-49
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0000000000146
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) A0A1B0CGB3
Sequence length 74
Comment (tr|A0A1B0CGB3|A0A1B0CGB3_LUTLO) Uncharacterized protein {ECO:0000313|VectorBase:LLOJ003414-PA} KW=Complete proteome; Reference proteome OX=7200 OS=Lutzomyia longipalpis (Sand fly). GN= OC=Psychodidae; Lutzomyia; Lutzomyia.
Sequence
MSNQTKQRIQVPDGLRDVLLEFSIAYLLEQPGDVVDYAVEFFTRLQENRKTNMVAVEAPS
PDESVMSQEEASFL
Download sequence
Identical sequences A0A1B0CGB3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]