SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for A0A1B0D6F3 from Uniprot 2018_03 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  A0A1B0D6F3
Domain Number 1 Region: 56-82
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000706
Family Somatomedin B domain 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) A0A1B0D6F3
Sequence length 85
Comment (tr|A0A1B0D6F3|A0A1B0D6F3_PHLPP) Uncharacterized protein {ECO:0000313|VectorBase:PPAI003062-PA} KW=Complete proteome; Reference proteome OX=29031 OS=Phlebotomus papatasi (Sandfly). GN= OC=Psychodidae; Phlebotomus; Phlebotomus.
Sequence
MVFDKTFVAIVLILCCLEASSVLAGSCRESSLCCNGRDSSCVVQKAPINAIIEDLSDKPC
YCDHACLRLGDCCEDFKQYCGGIYV
Download sequence
Identical sequences A0A1B0D6F3

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]